Protein coding transcript 96969

• Transcript: Ll_transcript_388705
• CDS coordinates: 3-695 (+)
• Peptide sequence: SLCHGYPSEFASYFHYCRSLRFDDKPDYAYLKRLFRDLFIREGFQFDYVFDWTILKYQQSQIGTPTRTIGSAAGPSSGMPPAVANADGQSRGEDGRQTGWLSSDPTRRRNSGPIANDVLLSRQKAPLINESTVSKDVMLSSSNFFQPSGSARRRAVSGGHDAVVGSETEPSRPPIMDSSQGALSKISGAQRNSTILPSDHNRVASGRNTSNVMNLETTLKGIEIRDPSIQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_388705

• Blastp: Casein kinase 1-like protein 2 from Arabidopsis with 60.35% of identity
• Blastx: Casein kinase 1-like protein 2 from Arabidopsis with 60.35% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT1G72710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424499.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;