Protein coding transcript 97705

• Transcript: Ll_transcript_388679
• CDS coordinates: 448-1248 (+)
• Peptide sequence: MATNENLPPNVIKQLAKELKNLDESPPEGIKVVVNDDDFSTIFADIDGPAGTPYENGVFRMKLLLSRDFPHSPPKGFFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLIEPFPESALNEQAGKLLLEDYDEYARHARLYTGIHAKPKPKFKSGAISESTTALNVDQTNTSVLSADIKTAPQGAALPLQSSLAPSTTATRGNGQEHAAVIPAETIVNASATVLSAAPVPQKKEGGQAKAQPDKKKIDARKRSLKRL*
• ORF Type: complete

Annotations of Ll_transcript_388679

• Blastp: Ubiquitin-conjugating enzyme E2 22 from Arabidopsis with 70.79% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 22 from Arabidopsis with 70.79% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT5G05080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429458.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;