Protein coding transcript 991

• Transcript: Ll_transcript_444214
• CDS coordinates: 28-489 (+)
• Peptide sequence: MATQRLSNVLSHITPGSKSPLEQITSQNPDDVVITLAIRTPLTKAGKGGLKDTPLDGLVFKILEQVVRKSRLDPQMVEDICLGNVSDSKAAYYGRAACLAAGFPTTTAASSVNRFCSSGLKAVQDIAAQIQTGAIEIGVAVGAEHMSTGGDRLE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_444214

• Blastp: 3-ketoacyl-CoA thiolase B, peroxisomal from Candida with 44.83% of identity
• Blastx: 3-ketoacyl-CoA thiolase B, peroxisomal from Candida with 44.14% of identity
• Eggnog: acetyl-coa acetyltransferase(COG0183)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015949425.1)
• Pfam: Thiolase, N-terminal domain (PF00108.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;