Protein coding transcript 998

• Transcript: Ll_transcript_432120
• CDS coordinates: 125-682 (+)
• Peptide sequence: MHPPMITTNPHAALLASPGMGHLIPMVELGKRLLTHHGFDVTIFVVTTDSSTTASQILQQTSNLSSLNIVVLPPIDFSSKPGPNPSLGEQVAIAMVESLPLLLSSIISMKLRPSTLIVDLFGTCAFPIARDFGMSTYVFFATSAWFSAVTIYVPVIDKEMEERHANNHEPLLIPGCESVRFEDTLE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_432120

• Blastp: UDP-glycosyltransferase 72E1 from Arabidopsis with 48.63% of identity
• Blastx: UDP-glycosyltransferase 72E1 from Arabidopsis with 48.63% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT3G50740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423461.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;