Protein coding transcript 1

• Transcript: Ll_transcript_495787
• CDS coordinates: 1-477 (+)
• Peptide sequence: DERGIPVPQTGNRDSLIASIRRHSYVAAQEANKKYNSATQQASNAQESLSNQLLESWSDSQVKEWLDKNGIPVPQGSKRNELSALARKHSARLAGTDVKNQAASAYGAATSSAGNYYAQATDDSYAGLRYYYDYALNQIGFASKEAKASLSSASDRASS
• ORF Type: internal

Annotations of Ll_transcript_495787

• Blastp: Stress response protein ish1 from Schizosaccharomyces with 41.27% of identity
• Blastx: Stress response protein ish1 from Schizosaccharomyces with 41.27% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC365.12c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: Putative stress-responsive nuclear envelope protein (PF10281.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;