Protein coding transcript 100011

• Transcript: Ll_transcript_460374
• CDS coordinates: 110-721 (+)
• Peptide sequence: MGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSAQPHGEQNLVTWARPLFNDRRKFSKLADPKLQGRFPMRGLYQALAVASMCIQESAATRPLIGDVVTALSYLANNAYDPKGSGGDDKRNKDDKGGRILKNDEAGGSGRRWDLEGSEKDDSPRETARMLDRERAVAEAKLWGENLREKRRQGALPGSFDGSNP*
• ORF Type: complete

Annotations of Ll_transcript_460374

• Blastp: Serine/threonine-protein kinase PBS1 from Arabidopsis with 80.1% of identity
• Blastx: Serine/threonine-protein kinase PBS1 from Arabidopsis with 80.52% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G13160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429576.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;