Transcript | Ll_transcript_460654 |
---|---|
CDS coordinates | 283-867 (+) |
Peptide sequence | MVDYWKPSHRLHHSTCSFISPYQKPSSVSYSSTMDISIIKEVFSSILSAAEVLGRRGDAFIKRVIESQSNLPPTKISRDGSIMEWAEDFVDPDIHHRHVSHLFGLFPGHTISLEQTPDLFKAVNSSLIKRGDEGPGWSTTWKASLWARLHNSEHAYHMIKHLINLVDPDHEGNYEGGVYSNLFTAHPPFQIDANF |
ORF Type | 3prime_partial |
Blastp | Alpha-L-fucosidase 2 from Arabidopsis with 71.35% of identity |
---|---|
Blastx | Alpha-L-fucosidase 2 from Arabidopsis with 71.35% of identity |
Eggnog | alpha-l-fucosidase(ENOG410XPGV) |
Kegg | Link to kegg annotations (AT4G34260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439048.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer