| Transcript | Ll_transcript_460656 |
|---|---|
| CDS coordinates | 180-491 (+) |
| Peptide sequence | MNYWPSLTCNLHECQEPLVDYISSLSVNGAKTAKVNYKANGWVAHQVSDIWAKTTADRGEAVWALWPMGGAWLCTHLWEHYTYTMDKVSSPFSVNCLSHGLKY* |
| ORF Type | complete |
| Blastp | Alpha-L-fucosidase 2 from Arabidopsis with 80.46% of identity |
|---|---|
| Blastx | Alpha-L-fucosidase 2 from Arabidopsis with 70.73% of identity |
| Eggnog | alpha-l-fucosidase(ENOG410XPGV) |
| Kegg | Link to kegg annotations (AT4G34260) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439048.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer