Protein coding transcript 100020

• Transcript: Ll_transcript_460657
• CDS coordinates: 374-1030 (+)
• Peptide sequence: MANGWSLALHPSVGALYLYNGQSHGGLLETNPSTSPEHMFTAPDQKPASVSYSSTMDISIIKEVFSSILSAAEVLGRRGDAFIKRVIESQSNLPPTKISRDGSIMEWAEDFVDPDIHHRHVSHLFGLFPGHTISLEQTPDLFKAVNSSLIKRGDEGPGWSTTWKASLWARLHNSEHAYHMIKHLINLVDPDHEGNYEGGVYSNLFTAHPPFQIDANFG*
• ORF Type: complete

Annotations of Ll_transcript_460657

• Blastp: Alpha-L-fucosidase 2 from Arabidopsis with 74.09% of identity
• Blastx: Alpha-L-fucosidase 2 from Arabidopsis with 71.5% of identity
• Eggnog: alpha-l-fucosidase(ENOG410XPGV)
• Kegg: Link to kegg annotations (AT4G34260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439048.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;