Protein coding transcript 100021

• Transcript: Ll_transcript_460658
• CDS coordinates: 374-1045 (+)
• Peptide sequence: MANGWSLALHPSVGALYLYNGQNWLIEGHGGLLETNPSTSPEHMFTAPDQKPASVSYSSTMDISIIKEVFSSILSAAEVLGRRGDAFIKRVIESQSNLPPTKISRDGSIMEWAEDFVDPDIHHRHVSHLFGLFPGHTISLEQTPDLFKAVNSSLIKRGDEGPGWSTTWKASLWARLHNSEHAYHMIKHLINLVDPDHEGNYEGGVYSNLFTAHPPFQIDANFG*
• ORF Type: complete

Annotations of Ll_transcript_460658

• Blastp: Alpha-L-fucosidase 2 from Arabidopsis with 73.13% of identity
• Blastx: Alpha-L-fucosidase 2 from Arabidopsis with 70.67% of identity
• Eggnog: alpha-l-fucosidase(ENOG410XPGV)
• Kegg: Link to kegg annotations (AT4G34260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439048.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;