Protein coding transcript 1001

• Transcript: Ll_transcript_432130
• CDS coordinates: 3-314 (+)
• Peptide sequence: NIVHFDLKCDNFLVNLGDPERPVCKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLYGNSSRVSEKVDIFSFGIAMWEILTGEEPYANMHCGAIIGGIVNNTLR
• ORF Type: internal

Annotations of Ll_transcript_432130

• Blastp: Mitogen-activated protein kinase kinase kinase 12 from Rattus with 44.12% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase 12 from Rattus with 44.12% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410YKX2)
• Kegg: Link to kegg annotations (25579)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459473.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;