Protein coding transcript 100168

• Transcript: Ll_transcript_459631
• CDS coordinates: 75-539 (+)
• Peptide sequence: MALFLCFFIFFFASPAAAAAACDSCVHQTKASQFSKASALSSGACGYGSFALGLSNGQLAAAVPSLFKDGAGCGACFQIRCKNPTLCTKAGTRVVVSDLNHNNQTDFVLSSRAFTAMAQKGMAQQILKLGIVDIEYKRVPCDYKNQKLAVRVEES
• ORF Type: 3prime_partial

Annotations of Ll_transcript_459631

• Blastp: Expansin-like A2 from Arabidopsis with 67.63% of identity
• Blastx: Expansin-like A2 from Arabidopsis with 66.91% of identity
• Eggnog: expansin-like(ENOG410YDTV)
• Kegg: Link to kegg annotations (AT4G38400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450911.1)
• Pfam: Lytic transglycolase (PF03330.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;