| Transcript | Ll_transcript_459633 |
|---|---|
| CDS coordinates | 3-344 (+) |
| Peptide sequence | STSCIAFISTLHYFQSKQNNKHVYMALFLCFFIFFFASPAAAAAACDSCVHQTKASQFSKASALSSGACGYGSFALGLSNGQLAAAVPSLFKDGAGCGACFQVPMSFLFIQII* |
| ORF Type | 5prime_partial |
| Blastp | Expansin-like A2 from Oryza sativa with 47.44% of identity |
|---|---|
| Blastx | Expansin-like A2 from Arabidopsis with 65.08% of identity |
| Eggnog | expansin-like(ENOG410YDTV) |
| Kegg | Link to kegg annotations (4349265) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450911.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer