Protein coding transcript 100184

• Transcript: Ll_transcript_459668
• CDS coordinates: 52-435 (+)
• Peptide sequence: MGANISNMECYPYASPQSSHILTFHSTSKWKAHFDASKGMNKLMVIDFTATWCGPCKYMDHVIQDFAAKYIEVEFIKIDVDELMGVSQEFQVQAMPAFILMKKGKVVDKLVGAKTEELEALIEKHLN*
• ORF Type: complete

Annotations of Ll_transcript_459668

• Blastp: Thioredoxin H2 from Arabidopsis with 46.3% of identity
• Blastx: Thioredoxin H2 from Arabidopsis with 46.3% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT5G39950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460362.1)
• Pfam: Phosducin (PF02114.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;