| Transcript | Ll_transcript_478219 |
|---|---|
| CDS coordinates | 242-604 (+) |
| Peptide sequence | MFILTYTGEHKHPKPAHRNSLAGSTRNKTTTTRLHQTQENGSPSSIDAVSPTQAITTSLSMNMDGEKLEPELGSGSDDEDVLIPNSMGLSETVFLSPNSVPRLDQDCSETSSNNTRLNPG* |
| ORF Type | complete |
| Blastp | Probable WRKY transcription factor 27 from Arabidopsis with 79.31% of identity |
|---|---|
| Blastx | Probable WRKY transcription factor 27 from Arabidopsis with 80% of identity |
| Eggnog | WRKY(ENOG41114CW) |
| Kegg | Link to kegg annotations (AT5G52830) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451516.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer