Transcript | Ll_transcript_461496 |
---|---|
CDS coordinates | 111-458 (+) |
Peptide sequence | MYEMLVGYPPFYSDDPMSTCRKIVNWKSHLKFPEEARLSREAKDLISKLLCNVNQRLGSNGAAEIKAHSFFEGTEWDKLYQMEAAFLPEVNDELDTQNFEKFEESDNHTQSSSRVG |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein kinase CBK1 from Pneumocystis with 46.09% of identity |
---|---|
Blastx | Serine/threonine-protein kinase CBK1 from Pneumocystis with 48.76% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424687.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer