Protein coding transcript 100266

• Transcript: Ll_transcript_461487
• CDS coordinates: 2-763 (+)
• Peptide sequence: GHVYAMKKLKKSEMLRRGQVEHVISERNLLAEVDSNCIVKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIESIHKRNYIHRDIKPDNLLLDRYGHLRLSDFGLCKPLDCRTLEEKDFSMGQNVNGTRFTRNDEHAAPKRTQQEQLQHWQQNRRTLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPFYSDEPMTTCRKIVNWQSHSKFPVEARLSLEAKDLIS
• ORF Type: internal

Annotations of Ll_transcript_461487

• Blastp: Serine/threonine-protein kinase 38-like from Homo with 55.6% of identity
• Blastx: Serine/threonine-protein kinase 38-like from Homo with 55.6% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQC0)
• Kegg: Link to kegg annotations (23012)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433044.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;