Transcript | Ll_transcript_460295 |
---|---|
CDS coordinates | 693-1301 (+) |
Peptide sequence | MARLFPEDQSQVNTRVAGTNGYMAPEYVMHGSLSVKADVFSYGVLVLELITGQRNSAFNLDVDAQSLLDWAYKQYKKGKSLDIVDSTLASSMEPEQVAMCIQLGLLCTQGDPQLRPNMRRVVMMLSRKPGHMDEPVRPGTPGSRYRRPRKHSAMSSTVDTSDSHTSDSSNNCTTRTTTATGTNSATNTIEIIDSKGKRPMQS* |
ORF Type | complete |
Blastp | Cysteine-rich receptor-like protein kinase 6 from Arabidopsis with 48.57% of identity |
---|---|
Blastx | Putative cysteine-rich receptor-like protein kinase 35 from Arabidopsis with 49.21% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G23140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464556.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer