Transcript | Ll_transcript_460305 |
---|---|
CDS coordinates | 1769-2104 (+) |
Peptide sequence | MEPEQVAMCIQLGLLCTQGDPQLRPNMRRVVMMLSRKPGHMDEPVRPGTPGSRYRRPRKHSAMSSTVDTSDSHTSDSSNNCTTRTTTATGTNSATNTIEIIDSKGKRPMQS* |
ORF Type | complete |
Blastp | G-type lectin S-receptor-like serine/threonine-protein kinase SRK from Arabidopsis with 38.67% of identity |
---|---|
Blastx | Putative cysteine-rich receptor-like protein kinase 35 from Arabidopsis with 52.68% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002499) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017442814.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer