Protein coding transcript 100278

• Transcript: Ll_transcript_460305
• CDS coordinates: 1769-2104 (+)
• Peptide sequence: MEPEQVAMCIQLGLLCTQGDPQLRPNMRRVVMMLSRKPGHMDEPVRPGTPGSRYRRPRKHSAMSSTVDTSDSHTSDSSNNCTTRTTTATGTNSATNTIEIIDSKGKRPMQS*
• ORF Type: complete

Annotations of Ll_transcript_460305

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase SRK from Arabidopsis with 38.67% of identity
• Blastx: Putative cysteine-rich receptor-like protein kinase 35 from Arabidopsis with 52.68% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002499)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017442814.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;