Protein coding transcript 100280

• Transcript: Ll_transcript_460297
• CDS coordinates: 194-700 (+)
• Peptide sequence: MDKPHNFLHSLINHFKFGSTGVLCLSEQNNEADLQRMAAQEQKIFAYETLVAATKNFNPIHKLGEGGFGPVYKGKLNDGREIAVKKLSQTSNQGKKEFKNEAKLLARVQHRNVVNLLGYCVHGTENILVYEYVPHESLDKLLFSKCFYVNPYPFQLLKSHMTRSRERI*
• ORF Type: complete

Annotations of Ll_transcript_460297

• Blastp: Cysteine-rich receptor-like protein kinase 19 from Arabidopsis with 59.6% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase SD1-29 from Arabidopsis with 50% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G23270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445853.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;