Transcript | Ll_transcript_460302 |
---|---|
CDS coordinates | 54-707 (+) |
Peptide sequence | MDKPHSFLHSLVKHFKFGSTTGQNNEADLQRMAAQEQKIFAYETLVVATKNFDATHKLGAGGFGPVYKGKLKDGREIAVKKLSQTSNQGKKEFLNEARLLARVQHRNVVNLLGYCVHGIEKLLVYEYVPHESLDKLLFKSQRRDELDWKRRFVIIKGVAKGLLYLHEDSHNCIIHRDIKASNILLDDKWSPKIADFGMARLFPEDQSQVNTRVAGTK* |
ORF Type | complete |
Blastp | Putative cysteine-rich receptor-like protein kinase 35 from Arabidopsis with 58.99% of identity |
---|---|
Blastx | Putative cysteine-rich receptor-like protein kinase 35 from Arabidopsis with 57.14% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G11530) |
CantataDB | Link to cantataDB annotations (CNT0002499) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017442814.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer