Protein coding transcript 100285

• Transcript: Ll_transcript_460302
• CDS coordinates: 54-707 (+)
• Peptide sequence: MDKPHSFLHSLVKHFKFGSTTGQNNEADLQRMAAQEQKIFAYETLVVATKNFDATHKLGAGGFGPVYKGKLKDGREIAVKKLSQTSNQGKKEFLNEARLLARVQHRNVVNLLGYCVHGIEKLLVYEYVPHESLDKLLFKSQRRDELDWKRRFVIIKGVAKGLLYLHEDSHNCIIHRDIKASNILLDDKWSPKIADFGMARLFPEDQSQVNTRVAGTK*
• ORF Type: complete

Annotations of Ll_transcript_460302

• Blastp: Putative cysteine-rich receptor-like protein kinase 35 from Arabidopsis with 58.99% of identity
• Blastx: Putative cysteine-rich receptor-like protein kinase 35 from Arabidopsis with 57.14% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G11530)
• CantataDB: Link to cantataDB annotations (CNT0002499)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017442814.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;