Protein coding transcript 100286

• Transcript: Ll_transcript_460303
• CDS coordinates: 711-1319 (+)
• Peptide sequence: MARLFPEDQSQVNTRVAGTNGYMAPEYVMHGSLSVKADVFSYGVLVLELITGQRNSAFNLDVDAQSLLDWAYKQYKKGKSLDIVDSTLASSMEPEQVAMCIQLGLLCTQGDPQLRPNMRRVVMMLSRKPGHMDEPVRPGTPGSRYRRPRKHSAMSSTVDTSDSHTSDSSNNCTTRTTTATGTNSATNTIEIIDSKGKRPMQS*
• ORF Type: complete

Annotations of Ll_transcript_460303

• Blastp: Cysteine-rich receptor-like protein kinase 6 from Arabidopsis with 48.57% of identity
• Blastx: Putative cysteine-rich receptor-like protein kinase 35 from Arabidopsis with 52.94% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G23140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464556.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;