Transcript | Ll_transcript_460418 |
---|---|
CDS coordinates | 439-741 (+) |
Peptide sequence | MNIAALLTSAGINIAICVVLFSLYSVLRKQPGNVSVYFGQRLSSQRSRRLDQCLERFVPSPSWILKAWETSEDEILATGGLDAVVFVRILVFRLLGPSKI* |
ORF Type | complete |
Blastp | CSC1-like protein RXW8 from Arabidopsis with 67.37% of identity |
---|---|
Blastx | CSC1-like protein RXW8 from Arabidopsis with 70.24% of identity |
Eggnog | transmembrane protein 63C(COG5594) |
Kegg | Link to kegg annotations (AT1G58520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458484.1) |
Pfam | Late exocytosis, associated with Golgi transport (PF13967.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer