Protein coding transcript 100310

• Transcript: Ll_transcript_460430
• CDS coordinates: 782-1546 (+)
• Peptide sequence: MKYWISVAWMLWFSAGCLSSANYYGQDRIHKDIPLESLEVFTIENVQEGSRLWAHCLALYIITLAACTLLYFEFKNVANLRLVHIIGPSAPNPSHFAILVRSIPWSSEESYCDTVKKFFSYYHPSTYLSHQMVYKSGTVQKLKDDAEHVCKVIRDTSLENTCKPSFTQCWCSGGTTNSFKMISNEIDIESVHGRTGYTDKHLDESKKECPAAFVFFKNRYAALMAAQTLQSSNPMLWVTDLAPEPHDVYWSNICI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_460430

• Blastp: CSC1-like protein RXW8 from Arabidopsis with 57.32% of identity
• Blastx: CSC1-like protein RXW8 from Arabidopsis with 57.32% of identity
• Eggnog: transmembrane protein 63C(COG5594)
• Kegg: Link to kegg annotations (AT1G58520)
• CantataDB: Link to cantataDB annotations (CNT0002313)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416620.1)
• Pfam: Late exocytosis, associated with Golgi transport (PF13967.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;