Protein coding transcript 100342

• Transcript: Ll_transcript_459796
• CDS coordinates: 220-660 (+)
• Peptide sequence: MTETYFLNIIFSIYLFVIGKACEAVNITEELLKLTNNVISRMMLGEAEEARDVVRGVTQIFGEFNVSDFIWLFKKLDLQGFEKRIEDLFQRFDTLVERIISKREEIRKNKRVKNGEIRDFLDVLLDCVEDESLEIKINRIHIKALIM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_459796

• Blastp: Licodione synthase from Glycyrrhiza with 77.54% of identity
• Blastx: Licodione synthase from Glycyrrhiza with 77.54% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAA22423)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454023.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;