Protein coding transcript 100373

• Transcript: Ll_transcript_461116
• CDS coordinates: 1-615 (+)
• Peptide sequence: VMVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLEHPQKETYWGNVNPIGVRSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVG
• ORF Type: internal

Annotations of Ll_transcript_461116

• Blastp: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 95.12% of identity
• Blastx: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 95.12% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT2G47650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441743.1)
• Pfam: GDP-mannose 4,6 dehydratase (PF16363.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;