Protein coding transcript 100456

• Transcript: Ll_transcript_461790
• CDS coordinates: 211-645 (+)
• Peptide sequence: MMEGEQDLSPPTSNVDTSQPSSGFPIGSTLPLIIVLTFSGILSCCYHRQKFCSFQTSLTQSNTTATSHHYSSSPNSNINSTESKQNKGQIMPVLMPGDDVPKFIAMPCPRKPSLSERIIVTVEKPPPAPKPPRVRVPLLNYQPN*
• ORF Type: complete

Annotations of Ll_transcript_461790

• Blastp: Uncharacterized protein At5g65660 from Arabidopsis with 45.32% of identity
• Blastx: Uncharacterized protein At5g65660 from Arabidopsis with 44.26% of identity
• Eggnog: hydroxyproline-rich glycoprotein(ENOG410XWC4)
• Kegg: Link to kegg annotations (AT5G65660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422803.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;