Transcript | Ll_transcript_460771 |
---|---|
CDS coordinates | 103-570 (+) |
Peptide sequence | MTFMTWSVIYIHLYNLQIKFASVDLELHTKYVPGGQESIYDVDRRVSERTQVTPPFPEDRFLCSFSHIFAGGYAAGYYSYKWAEVLSADAFSAFEDAGLDNKKAVEETGHKFRETVLALGGGKAPLEVFVQFRGREPTPDALLRHNGLLSVPASA* |
ORF Type | complete |
Blastp | Organellar oligopeptidase A, chloroplastic/mitochondrial from Arabidopsis with 84.17% of identity |
---|---|
Blastx | Organellar oligopeptidase A, chloroplastic/mitochondrial from Arabidopsis with 84.17% of identity |
Eggnog | oligopeptidase a(COG0339) |
Kegg | Link to kegg annotations (AT5G65620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445352.1) |
Pfam | Peptidase family M3 (PF01432.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer