Protein coding transcript 100505

• Transcript: Ll_transcript_459740
• CDS coordinates: 3-305 (+)
• Peptide sequence: KTARIFIQEAKYSFHLAEPGYHWIRLHFYPVKNNVFDLQKATFSVNTNVYVLLHSFNVNNTDRPILKEYLINANESQFTLIFTPLKNSAAFINAVEVVSAP
• ORF Type: internal

Annotations of Ll_transcript_459740

• Blastp: Probable receptor-like protein kinase At4g39110 from Arabidopsis with 58.65% of identity
• Blastx: Probable receptor-like protein kinase At4g39110 from Arabidopsis with 58.65% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G39110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413653.1)
• Pfam: Carbohydrate-binding protein of the ER (PF12819.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;