Transcript | Ll_transcript_459740 |
---|---|
CDS coordinates | 3-305 (+) |
Peptide sequence | KTARIFIQEAKYSFHLAEPGYHWIRLHFYPVKNNVFDLQKATFSVNTNVYVLLHSFNVNNTDRPILKEYLINANESQFTLIFTPLKNSAAFINAVEVVSAP |
ORF Type | internal |
Blastp | Probable receptor-like protein kinase At4g39110 from Arabidopsis with 58.65% of identity |
---|---|
Blastx | Probable receptor-like protein kinase At4g39110 from Arabidopsis with 58.65% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G39110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413653.1) |
Pfam | Carbohydrate-binding protein of the ER (PF12819.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer