Protein coding transcript 10056

• Transcript: Ll_transcript_478176
• CDS coordinates: 763-1230 (+)
• Peptide sequence: MHNIADLLKESKGDVQKESIELNIEELKTLLSKVDSQMKFLPATAQVASQQGTYLAKCFNRMEECEKNPEGPLRYRGEGRHRFKPFRYRHLGQFAPLGGEQTAAQLPGDWVSIGQSSQWLWYSVYASKQVSWRTRALVVTDWTRRFIFGRDSSQI*
• ORF Type: complete

Annotations of Ll_transcript_478176

• Blastp: External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial from Arabidopsis with 82.69% of identity
• Blastx: External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial from Arabidopsis with 80.6% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G05020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431453.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;