Transcript | Ll_transcript_462392 |
---|---|
CDS coordinates | 1561-1929 (+) |
Peptide sequence | MTKIADSLGLRSNEEVLIEAVALEKLKENAEQTEHTAEAEYIDEIIAVVTCMHERLVMLKQAQSCSPVPVPADFCCPLSLELMTDPVIVASGQTYERFSSRTGLTLALMFVQRHARLCLIPT* |
ORF Type | complete |
Blastp | U-box domain-containing protein 4 from Arabidopsis with 46.83% of identity |
---|---|
Blastx | U-box domain-containing protein 4 from Arabidopsis with 46.87% of identity |
Eggnog | U-box domain-containing protein 4-like(ENOG410XU9Y) |
Kegg | Link to kegg annotations (AT2G23140) |
CantataDB | Link to cantataDB annotations (CNT0002429) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434108.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer