Protein coding transcript 100606

• Transcript: Ll_transcript_462303
• CDS coordinates: 198-512 (+)
• Peptide sequence: MPEIPEHLSNDAKNFIKLCLQRDPSARPTAQMLLDHPFIRDQSATKSMNVRITRDAFPYMLDGSRTPPVLEHHSNSNRTNNTLIDGDYATKQVVASSRAVKSTR*
• ORF Type: complete

Annotations of Ll_transcript_462303

• Blastp: Mitogen-activated protein kinase kinase kinase 3 from Arabidopsis with 56.45% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase 3 from Arabidopsis with 47.86% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT1G53570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415082.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;