Transcript | Ll_transcript_462318 |
---|---|
CDS coordinates | 55-687 (+) |
Peptide sequence | MATSNPPWSQYEGVAAIFKIGNSKDMPEIPEHLSNDAKNFIKLCLQRDPSARPTAQMLLDHPFIRDQSATKSVNVSLTRDAFPYTFDGSQTPPVLEHHSNSNRTNNNLINGDYATKQVVGSSRAVRSPRDNTRMITSLPVSPCSSPLRQYGPADRSCFLSPHPSYTMMGQNNLNSYPLRSNAAFTLDPWQERSPYRGHTPSGGSPRTRLI* |
ORF Type | complete |
Blastp | Mitogen-activated protein kinase kinase kinase 3 from Arabidopsis with 55.93% of identity |
---|---|
Blastx | Mitogen-activated protein kinase kinase kinase 3 from Arabidopsis with 54.32% of identity |
Eggnog | mitogen-activated protein kinase kinase kinase(ENOG410XQGS) |
Kegg | Link to kegg annotations (AT1G53570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415082.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer