Transcript | Ll_transcript_461713 |
---|---|
CDS coordinates | 57-449 (+) |
Peptide sequence | MAVASHKPIPLLKDELDIVIPTIRNLDFLEMWRPFFEPYHLIIVQDGDPSKVIKVPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVRFTFLCVLCFVDLKVLSLKFN* |
ORF Type | complete |
Blastp | Alpha-1,4-glucan-protein synthase [UDP-forming] 2 from Solanum with 92.66% of identity |
---|---|
Blastx | Alpha-1,4-glucan-protein synthase [UDP-forming] 2 from Solanum with 92.66% of identity |
Eggnog | reversibly glycosylated polypeptide(ENOG411144T) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456468.1) |
Pfam | Reversibly glycosylated polypeptide (PF03214.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer