Protein coding transcript 100669

• Transcript: Ll_transcript_461059
• CDS coordinates: 3-593 (+)
• Peptide sequence: CCEKAHTNKGAWTKEEDDRLISYIHAHGEGSWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEQEDELIIKLHSLLGNKWSLIAGRLAGRTDNEIKNYWNTHIRRKLLNRGIDPATHRPLNDQEVQASVAATNTISFASSASAAIVKQEQDTSITSESSIFCVVGENNSKVGKGTLLERCPDLNLELTMSPPR
• ORF Type: internal

Annotations of Ll_transcript_461059

• Blastp: Myb-related protein 308 from Antirrhinum with 72.45% of identity
• Blastx: Myb-related protein 308 from Antirrhinum with 70.41% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454241.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;