Protein coding transcript 10072

• Transcript: Ll_transcript_478197
• CDS coordinates: 175-600 (+)
• Peptide sequence: MHKFSSVSRILGAIIINAEYGYSMNITEKSDVYSYGVVLLEILSGRSAVESNVGDGQHIVEWVKRKMGSFEPAVSILDTKLQGLPNQMVQEMLQTLGIAMFCVNSSPAERPTMKEVIALLMEVKSQPEEMSKTSQPLIKQS*
• ORF Type: complete

Annotations of Ll_transcript_478197

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g34110 from Arabidopsis with 76.81% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g34110 from Arabidopsis with 70.97% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G34110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003535558.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;