Protein coding transcript 100752

• Transcript: Ll_transcript_460731
• CDS coordinates: 3-317 (+)
• Peptide sequence: HMDGSSFYVVGYGNGAWTEDKRQLYNLVDGITRYTTQVYPNSWTAILVSLDNKGMWNLRSAIWERQYLGQQLYLRVWNAQHSLANEYDIPTNVLLCGKAVGYHH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_460731

• Blastp: L-ascorbate oxidase homolog from Nicotiana with 54.46% of identity
• Blastx: L-ascorbate oxidase homolog from Nicotiana with 54.46% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107766889)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446721.1)
• Pfam: Multicopper oxidase (PF07731.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;