Protein coding transcript 100758

• Transcript: Ll_transcript_460740
• CDS coordinates: 415-723 (+)
• Peptide sequence: MFRISNVGLSTSINFRIQGHTLKLVEVEGSHTVQNIYNSLDVHVGQSVSVLVTLNNSPEDYYIVASTRFSKKILTATAVLHYTNSHSPASGPLPSPPTYQYHW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_460740

• Blastp: L-ascorbate oxidase homolog from Nicotiana with 57.29% of identity
• Blastx: L-ascorbate oxidase homolog from Nicotiana with 38.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107766889)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446720.1)
• Pfam: Multicopper oxidase (PF00394.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;