Protein coding transcript 100776

• Transcript: Ll_transcript_462059
• CDS coordinates: 225-986 (+)
• Peptide sequence: MMIQRTVCFSSLRKLLHQAGCVSSSSKVGAYNGYASQSSSSLPLPFPSYSGEEYADVDWDSLGFGLVPTDYMYINKCSAGHNFGDGQLNRYGHIELSPSAGVLNYGQGLFEGTKAYRKEDGKLLLFRPEQNAIRMQNGAERMCMISPSIEQFVHALKQTVLANKRWVPPPGKGSLYLRPLLLGTGPVLGLAPAPEYTFLIYASPVRNYFKEGSAPLNLYVEEDYDRASRRGTGSVKTISNYAPVCISIFKSFN*
• ORF Type: complete

Annotations of Ll_transcript_462059

• Blastp: Branched-chain-amino-acid aminotransferase 2, chloroplastic from Arabidopsis with 64.41% of identity
• Blastx: Branched-chain amino acid aminotransferase 2, chloroplastic from Humulus with 72.4% of identity
• Eggnog: brancheD-chain amino acid aminotransferase(COG0115)
• Kegg: Link to kegg annotations (AT1G10070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437870.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;