Transcript | Ll_transcript_462062 |
---|---|
CDS coordinates | 1179-1538 (+) |
Peptide sequence | MQNGAERMCMISPSIEQFVHALKQTVLANKRWVPPPGKGSLYLRPLLLGTGPVLGLAPAPEYTFLIYASPVRNYFKEGSAPLNLYVEEDYDRASRRGTGSVKTISNYAPVCISIFKSFN* |
ORF Type | complete |
Blastp | Branched-chain-amino-acid aminotransferase 5, chloroplastic from Arabidopsis with 75.45% of identity |
---|---|
Blastx | Branched-chain-amino-acid aminotransferase 5, chloroplastic from Arabidopsis with 76.81% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT5G65780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437869.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer