Transcript | Ll_transcript_462069 |
---|---|
CDS coordinates | 225-986 (+) |
Peptide sequence | MMIQRTVCFSSLRKLLHQAGCVSSSSKVGAYNGYASQSSSSLPLPFPSYSGEEYADVDWDSLGFGLVPTDYMYINKCSAGHNFGDGQLNRYGHIELSPSAGVLNYGQGLFEGTKAYRKEDGKLLLFRPEQNAIRMQNGAERMCMISPSIEQFVHALKQTVLANKRWVPPPGKGSLYLRPLLLGTGPVLGLAPAPEYTFLIYASPVRNYFKEGSAPLNLYVEEDYDRASRRGTGSVKTISNYAPVCISIFKSFN* |
ORF Type | complete |
Blastp | Branched-chain-amino-acid aminotransferase 2, chloroplastic from Arabidopsis with 64.41% of identity |
---|---|
Blastx | Branched-chain amino acid aminotransferase 2, chloroplastic from Humulus with 72.4% of identity |
Eggnog | brancheD-chain amino acid aminotransferase(COG0115) |
Kegg | Link to kegg annotations (AT1G10070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437870.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer