Protein coding transcript 100782

• Transcript: Ll_transcript_462072
• CDS coordinates: 1179-1538 (+)
• Peptide sequence: MQNGAERMCMISPSIEQFVHALKQTVLANKRWVPPPGKGSLYLRPLLLGTGPVLGLAPAPEYTFLIYASPVRNYFKEGSAPLNLYVEEDYDRASRRGTGSVKTISNYAPVCISIFKSFN*
• ORF Type: complete

Annotations of Ll_transcript_462072

• Blastp: Branched-chain-amino-acid aminotransferase 5, chloroplastic from Arabidopsis with 75.45% of identity
• Blastx: Branched-chain-amino-acid aminotransferase 5, chloroplastic from Arabidopsis with 76.81% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G65780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437869.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;