Protein coding transcript 100783

• Transcript: Ll_transcript_462070
• CDS coordinates: 185-1123 (+)
• Peptide sequence: MELDFHNTPPPAMLSFFFFLLIVVSIVLKSKAKPSNSKLPPGPPKLPIIGNMHQLGAMPHHGLAKLSQQYGPLMHIKLGELPTTVVSSPEIAKEIMRTHDIIFANRPHLLAADIITYGSKGMTFSPYGSYWRQMRKICTLELLTAKRVESFRMVRKAEASNLVKEICSSEGSCINLSRIISLFTCGLTSRIAFGGKSKDEEAFVDTMKDVSKVIGGFSISDLYPSVEVLQILTGLRSKVEKIHQEIDRILESIVREHRDKTSESKGTNEKEDEDLVDVLLKLRKQENLEHPLSDNVIKGTILVSILQLEMAS*
• ORF Type: complete

Annotations of Ll_transcript_462070

• Blastp: Cytochrome P450 71D8 from Soja with 46.67% of identity
• Blastx: Cytochrome P450 71D9 from Soja with 66.34% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (100780605)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431059.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;