Transcript | Ll_transcript_460179 |
---|---|
CDS coordinates | 574-1617 (+) |
Peptide sequence | MSGQVVPFECEINLIHAYKCREYGKLTFVIVGKHSFNHKSLHSIGSTPNPYEQAISIIGRTLSSFDEDNLIPCFGFGDASTHDKNVFSFYPDDRYCHGFEEALARYRDIVPHLKLSGPTSFAPVIDAAIDIVDRSNGQYHVLVIIADGQVTRNSDTPHGKLSRQEQATVNSIVAASHYPLSIILVGVGDGPWDEMQHFDDSITQRLFDNFQFVNFTKIMSENKEASKKEAAFALAALMEIPIQYRAAQNLPVANEESSRYQRKRPLPPPKEVIDHDSAVLQVPSMTKFQSFEPTAPPETESVCPVCLTNPKDMAFGCGHTTCKECGVTLSSCPMCRQQITTRLRLYT* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase RGLG3 from Arabidopsis with 70.03% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase RGLG3 from Arabidopsis with 70.03% of identity |
Eggnog | copine family(ENOG410XPC8) |
Kegg | Link to kegg annotations (AT5G63970) |
CantataDB | Link to cantataDB annotations (CNT0001273) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462932.1) |
Pfam | Copine (PF07002.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer