Transcript | Ll_transcript_461074 |
---|---|
CDS coordinates | 388-816 (+) |
Peptide sequence | MDKNPSSASDGKAAFLRVRKWTRKVNLFEKDYIFIPVNFNLHWSLIVICHPGEVVNFKDKELDKSLKVPCILHMDSIKGSHSGLKNLLQRYLWEEWKERHKDALEENLSSRFLHMRFLPLVVLCANILMIFKLGEDIIYHPL* |
ORF Type | complete |
Blastp | Probable ubiquitin-like-specific protease 2B from Arabidopsis with 73.33% of identity |
---|---|
Blastx | Probable ubiquitin-like-specific protease 2B from Arabidopsis with 74.83% of identity |
Eggnog | SUMO1 sentrin specific peptidase(COG5160) |
Kegg | Link to kegg annotations (AT1G09730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417103.1) |
Pfam | Ulp1 protease family, C-terminal catalytic domain (PF02902.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer