Protein coding transcript 100981

• Transcript: Ll_transcript_461917
• CDS coordinates: 3-374 (+)
• Peptide sequence: PTSNQAKKKRSLPGTPDPDAEVIALSPKSLMATNRFICEICKKGFQRDQNLQLHRRGHNLPWKLKQRNKQEVIKKKVYVCPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCNKCSKKYAV
• ORF Type: internal

Annotations of Ll_transcript_461917

• Blastp: Zinc finger protein JACKDAW from Arabidopsis with 86.89% of identity
• Blastx: Zinc finger protein JACKDAW from Arabidopsis with 86.89% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT5G03150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458441.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;