Protein coding transcript 100992

• Transcript: Ll_transcript_461916
• CDS coordinates: 572-1099 (+)
• Peptide sequence: MEAASSSTPFLGIRQENQSQIAQHQGSQTAASTIVPQKKKKNHPGTAYPGFQREQNLQLHRRGHNLPWKLKQKSTKEQKRKVYLCPEPTCVHHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYRCDCGTLFSRLTRTRKKIIPYLPRRQFLSI*
• ORF Type: complete

Annotations of Ll_transcript_461916

• Blastp: Protein indeterminate-domain 4, chloroplastic from Arabidopsis with 71.9% of identity
• Blastx: Protein indeterminate-domain 4, chloroplastic from Arabidopsis with 71.9% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT2G02080)
• CantataDB: Link to cantataDB annotations (CNT0000237)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454642.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;