Protein coding transcript 100998

• Transcript: Ll_transcript_461921
• CDS coordinates: 113-484 (+)
• Peptide sequence: MATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVIRKKVYVCPEESCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVHSDWKAHSKTCGTKEYRCDCGTLFSRRDSF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_461921

• Blastp: Protein indeterminate-domain 1 from Arabidopsis with 91.13% of identity
• Blastx: Protein indeterminate-domain 11 from Arabidopsis with 94.93% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT5G66730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435341.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;