Protein coding transcript 10102

• Transcript: Ll_transcript_478125
• CDS coordinates: 323-1141 (+)
• Peptide sequence: MEALVCRELGDPTVSVEDKSSPTIVSKNHPIPQLNSPTSVRVRVKATSLNFANYLQVMGKYQEKPPLPFIPGSDFSGYVDAVGPKVSNFRVGDPVCSFAALGSFAEFIVVDETQLFQVPEGCDLVAAGALAVASGTSHVALVHRAQLKPGQVLLVLGAAGGVGLAAVQIGKACGAIVIAVARGAEKVQLLKSLGVDHVVDLTSENVIPSVKEFLKTRKLKGVDVLYDPVGGKLTKESLKLLNWGANILIIGFASGEVPVIPVNISLVKVHLE*
• ORF Type: complete

Annotations of Ll_transcript_478125

• Blastp: Quinone oxidoreductase-like protein 2 homolog from Nematostella with 41.64% of identity
• Blastx: Quinone oxidoreductase-like protein 2 homolog from Nematostella with 41.64% of identity
• Eggnog: alcohol dehydrogenase(COG0604)
• Kegg: Link to kegg annotations (NEMVE_v1g238856)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417509.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;