Protein coding transcript 101059

• Transcript: Ll_transcript_460898
• CDS coordinates: 213-998 (+)
• Peptide sequence: MHVIIMILFYFIAVNKVETLKRYKFSFAFENSNEEDYVTEKYFQSLVAGTVPVVVGAPNIQDFAPSPGSVLHIKGVEDVESIAKTMKHLAENPEAYNQSLRWKYEGPSDSFKALVDMAAVHSSCRLCIHLATTIREKEEASPGFKKRPCKCTRGSETVYHIYVRERGRFEMESIFLRSSNLTPEALKSAVALKFKSLNHVPIWKPERPEMLRGGNELKIYRIYPAGLTQRQALYSFSFKGDVDFRSHLDINPCAKFEVIFV*
• ORF Type: complete

Annotations of Ll_transcript_460898

• Blastp: Glycoprotein 3-alpha-L-fucosyltransferase A from Arabidopsis with 71.89% of identity
• Blastx: Putative fucosyltransferase-like protein from Arabidopsis with 73.49% of identity
• Eggnog: (Alpha (1,3) fucosyltransferase(ENOG410ZIMX)
• Kegg: Link to kegg annotations (AT3G19280)
• CantataDB: Link to cantataDB annotations (CNT0002743)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445792.1)
• Pfam: Glycosyltransferase family 10 (fucosyltransferase) C-term (PF00852.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;